PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DL_EECCC4DBF.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 164aa    MW: 18035.4 Da    PI: 9.8142
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DL_EECCC4DBF.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_155.99.4e-1892148359
                            XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                            e+ r++r+++NRe+A rsR+RK+a++eeLe++v  L   N +Lkk+ +elk eva+l
  Traes_7DL_EECCC4DBF.1  92 EDPRTIRMMRNRESALRSRARKRAYVEELEKEVRRLVDDNLKLKKQCKELKREVAAL 148
                            5789*************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.9E-1590154IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.0E-1791148No hitNo description
PROSITE profilePS5021711.50792148IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.19E-1395148No hitNo description
PfamPF001702.9E-1495148IPR004827Basic-leucine zipper domain
CDDcd147075.49E-1898148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MANYRLGGGG NGHYEMAAAA AAAWREPESP QLSLMSGCSS LFSISGLRDD DTDLHLLAGA  60
RSLPSTPVSF GGFPGGYEVD MELRQGGGSS GEDPRTIRMM RNRESALRSR ARKRAYVEEL  120
EKEVRRLVDD NLKLKKQCKE LKREVAALIL PTKSSLRRTS STQF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2490121e-175AK249012.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf15j05, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015642449.12e-73PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643092.12e-73PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643093.12e-73PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643094.12e-73PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643106.12e-73PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_015643107.12e-73PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLW5I4A31e-117W5I4A3_WHEAT; Uncharacterized protein
STRINGMLOC_14243.11e-103(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40173072
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35900.14e-10bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]